PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016437991.1
Common NameAGP3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 259aa    MW: 29096.9 Da    PI: 6.7439
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016437991.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.34.4e-18172206135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  XP_016437991.1 172 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRL 206
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.8E-802252IPR016679Transcription factor, GATA, plant
Gene3DG3DSA:3.30.50.105.5E-14165203IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.266166202IPR000679Zinc finger, GATA-type
SMARTSM004016.5E-16166216IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.08E-15167230No hitNo description
CDDcd002021.08E-13171218No hitNo description
PROSITE patternPS003440172197IPR000679Zinc finger, GATA-type
PfamPF003207.1E-16172206IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MDVYGVSAPD LFRIDDLLDF SNDEIFSINS NSSSTTATPD SQHHHHHLHQ PHSDNSSAAT  60
ANYYDALLPN CSDDFTDNLC VPSDDVAELE WLSNFVEDSF SNFPTNSITG TMNLSSNSTA  120
SFHSRSRSKR SRSTSSWTSS LQNPNTTMKN KEISVHTRER SSSMDDDVPR RCTHCASEKT  180
PQWRTGPLGP KTLCNACGVR FKSGRLVPEY RPAASPTFVL TQHSNSHRKV MELRRQKEMV  240
HQQPPPTEEG MYGNHFRVC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124129RSRSKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1076910.0AB107691.1 Nicotiana tabacum AGP3 mRNA for AG-motif binding protein-3, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016437991.10.0PREDICTED: GATA transcription factor 4-like
SwissprotO497439e-73GATA4_ARATH; GATA transcription factor 4
TrEMBLQ76DY11e-155Q76DY1_TOBAC; AG-motif binding protein-3
STRINGPGSC0003DMT4000669531e-141(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57761935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.15e-63GATA transcription factor 4
Publications ? help Back to Top
  1. Sugimoto K,Takeda S,Hirochika H
    Transcriptional activation mediated by binding of a plant GATA-type zinc finger protein AGP1 to the AG-motif (AGATCCAA) of the wound-inducible Myb gene NtMyb2.
    Plant J., 2003. 36(4): p. 550-64
    [PMID:14617085]